General Information

  • ID:  hor005173
  • Uniprot ID:  P01295
  • Protein name:  Gastrin-releasing peptide
  • Gene name:  GRP
  • Organism:  Gallus gallus (Chicken)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  animal
  • Expression:  anterior pituitary
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0090277 positive regulation of peptide hormone secretion; GO:1900738 positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle; GO:0034774 secretory granule lumen

Sequence Information

  • Sequence:  APLQPGGSPALTKIYPRGSHWAVGHLM
  • Length:  27
  • Propeptide:  MGGGGPRRPGTLPLLALLALLAAHGGAAPLQPGGSPALTKIYPRGSHWAVGHLMGKKSTGDFPYAYEEENKIPLSASPENIKQLDDYLQREEMSKHLLQLLEGNENKSAHFSKGGLPWHTRNSWETDDSSSWKDVSRTRCVSAFLTVTFCSKVAYQLCPTSALS
  • Signal peptide:  MGGGGPRRPGTLPLLALLALLAAHGGA
  • Modification:  T27 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the release of gastrin and other gastrointestinal hormones (Probable). Stimulates pancreatic protein and fluid secretion, and increases acid secretion from the avian proventriculus.
  • Mechanism:  Activation of cGRPR leads to IP3 accumulation and DAG production, which subsequently triggers multiple downstream signaling pathways, such as calcium mobilization and ERK signaling pathways; activation of cBRS3 also stimulates MAPK/ERK and AC/cAMP/PKA/CREB signaling pathways
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: 3.4nM;8.3nM
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01295-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005173_AF2.pdbhor005173_ESM.pdb

Physical Information

Mass: 330626 Formula: C130H201N37O33S
Absent amino acids: CDEFN Common amino acids: GP
pI: 10.45 Basic residues: 4
Polar residues: 8 Hydrophobic residues: 9
Hydrophobicity: -12.59 Boman Index: -725
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 79.63
Instability Index: 4965.93 Extinction Coefficient cystines: 6990
Absorbance 280nm: 268.85

Literature

  • PubMed ID:  7215543
  • Title:  Characterization of an avian gastric (proventricular) peptide having sequence homology with the porcine gastrin-releasing peptide and the amphibian peptides bombesin and alytesin.
  • PubMed ID:  2297533
  • Title:  Isolation, sequence and biosynthetic significance of a novel fragment of gastrin-releasing peptide from chicken proventriculus.
  • PubMed ID:  28500250
  • Title:  Characterization of NMB, GRP and their receptors (BRS3, NMBR and GRPR) in chickens.